Iright
BRAND / VENDOR: Proteintech

Proteintech, 31930-1-AP, KIR2DL2 Polyclonal antibody

CATALOG NUMBER: 31930-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The KIR2DL2 (31930-1-AP) by Proteintech is a Polyclonal antibody targeting KIR2DL2 in WB, ELISA applications with reactivity to human samples 31930-1-AP targets KIR2DL2 in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HuT 78 cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Background Information KIR2DL2 is one of killer cell immunoglobulin-like receptors, which are transmembrane glycoproteins expressed by natural killer cells and subsets of T cells. KIR proteins with the long cytoplasmic domain transduce inhibitory signals upon ligand binding via an immune tyrosine-based inhibitory motif (ITIM), while KIR proteins with the short cytoplasmic domain lack the ITIM motif and instead associate with the TYRO protein tyrosine kinase binding protein to transduce activating signals. The ligands for several KIR proteins are subsets of HLA class I molecules; thus, KIR proteins are thought to play an important role in regulation of the immune response. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag35284 Product name: Recombinant human KIR2DL2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 22-245 aa of NM_014219 Sequence: HEGVHRKPSLLAHPGRLVKSEETVILQCWSDVRFEHFLLHREGKFKDTLHLIGEHHDGVSKANFSIGPMMQDLAGTYRCYGSVTHSPYQLSAPSDPLDIVITGLYEKPSLSAQPGPTVLAGESVTLSCSSRSSYDMYHLSREGEAHECRFSAGPKVNGTFQADFPLGPATHGGTYRCFGSFRDSPYEWSNSSDPLLVSVIGNPSNSWPSPTEPSSKTGNPRHLH Predict reactive species Full Name: killer cell immunoglobulin-like receptor, two domains, long cytoplasmic tail, 2 Calculated Molecular Weight: 38 kDa Observed Molecular Weight: 60,30 kDa GenBank Accession Number: NM_014219 Gene Symbol: KIR2DL2 Gene ID (NCBI): 3803 RRID: AB_3670150 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: P43627 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924