Iright
BRAND / VENDOR: Proteintech

Proteintech, 31934-1-AP, ZNF787 Polyclonal antibody

CATALOG NUMBER: 31934-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The ZNF787 (31934-1-AP) by Proteintech is a Polyclonal antibody targeting ZNF787 in WB, IF/ICC, ELISA applications with reactivity to human, mouse samples 31934-1-AP targets ZNF787 in WB, IF/ICC, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: HEK-293T cells, HeLa cells, Jurkat cells, U-251 cells, RT-4 cells, NIH/3T3 cells Positive IF/ICC detected in: A431 cells Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information Zinc finger protein 787 (ZNF787, also known as TIP20) is activated in the nucleus and may be involved in transcriptional regulation. It probably is one repressor of neuronal features and can interact with histone deacetylase 1 (HDAC1) in regulating the permeability of the blood-brain barrier (BBB) as well as the pathogenesis of Alzheimer's disease (PMID: 33057419; 38329647). Specification Tested Reactivity: human, mouse Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag36052 Product name: Recombinant human ZNF787 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-50 aa of BC077728 Sequence: MELREEAWSPGPLDSEDQQMASHENPVDILIMDDDDVPSWPPTKLSPPQS Predict reactive species Full Name: zinc finger protein 787 Calculated Molecular Weight: 40 kDa Observed Molecular Weight: 40-50 kDa GenBank Accession Number: BC077728 Gene Symbol: ZNF787 Gene ID (NCBI): 126208 RRID: AB_3670151 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: Q6DD87 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924