Iright
BRAND / VENDOR: Proteintech

Proteintech, 31967-1-AP, SHB Polyclonal antibody

CATALOG NUMBER: 31967-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • ddddd

    99 xxxxxx

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The SHB (31967-1-AP) by Proteintech is a Polyclonal antibody targeting SHB in WB, ELISA applications with reactivity to human, mouse, rat samples 31967-1-AP targets SHB in WB, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HUVEC cells, L02 cells, C2C12 cells, H9C2 cells Recommended dilution Western Blot (WB): WB : 1:2000-1:10000 Background Information SH2 domain-containing adapter protein B (SHB) is an adaptor protein that operates downstream of tyrosine kinases. It is crucial in various cellular responses, including cell survival, differentiation, and proliferation (PMID: 29792386). SHB is involved in the modulation of focal adhesion kinase (FAK) signaling, which is important for regulating cell cycle progression in hematopoietic stem cells (PMID: 23528453). The protein has also been implicated in the progression of myeloproliferative disorders by affecting the activity of FAK and other signaling intermediates (PMID: 24952416). Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag35936 Product name: Recombinant human SHB protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 214-375 aa of BC136581 Sequence: ACGGKKLLNKCAASAAEESGAGKKDKVTIADDYSDPFDAKNDLKSKAGKGESAGYMEPYEAQRIMTEFQRQESVRSQHKGIQLYDTPYEPEGQSVDSDSESTVSPRLRESKLPQDDDRPADEYDQPWEWNRVTIPALAAQFNGNEKRQSSPSPSRDRRRQLR Predict reactive species Full Name: Src homology 2 domain containing adaptor protein B Calculated Molecular Weight: 55 kDa Observed Molecular Weight: 55 kDa GenBank Accession Number: BC136581 Gene Symbol: SHB Gene ID (NCBI): 6461 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: Q15464 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924