Proteintech, 31987-1-AP, SUCNR1/GPR91 Polyclonal antibody

Size: 20ul / 150ul The SUCNR1/GPR91 (31987-1-AP) by Proteintech is a Polyclonal antibody targeting SUCNR1/GPR91 in IHC, ELISA applications with reactivity to human, mouse samples 31987-1-AP targets SUCNR1/GPR91 in IHC, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive IHC detected in: mouse kidney tissue, mouse liver tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information SUCNR1 (Succinate Receptor 1), also known as GPR91, belongs to the family of G protein-coupled receptors (GPCRs) (PMID: 26808164). SUCNR1 has been identified as a receptor for the metabolite succinate, which functions as a metabolic stress signal in various tissues, including the liver, kidney, adipose tissue, and retina (PMID: 29968758). SUCNR1 is crucial in linking metabolic stress, inflammation, and energy homeostasis. It mediates signaling through Gq/GNAQ or Gi/GNAI second messengers, depending on the cell type and regulated processes. Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag34053 Product name: Recombinant human SUCNR1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 282-334 aa of BC030948 Sequence: PLAFLNSVINPVFYFLLGDHFRDMLMNQLRHNFKSLTSFSRWAHELLLSFREK Predict reactive species Full Name: succinate receptor 1 GenBank Accession Number: BC030948 Gene Symbol: SUCNR1 Gene ID (NCBI): 56670 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: Q9BXA5 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.