Proteintech, 31996-1-AP, CCDC97 Polyclonal antibody

Size: 20ul / 150ul The CCDC97 (31996-1-AP) by Proteintech is a Polyclonal antibody targeting CCDC97 in WB, ELISA applications with reactivity to human samples 31996-1-AP targets CCDC97 in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: Jurkat cells, RT-4 cells, HeLa cells Recommended dilution Western Blot (WB): WB : 1:1000-1:8000 Background Information CCDC97 is one of CCDC family proteins. Alterations in expression, mutation, and DNA promoter methylation of CCDC family genes have been shown to be associated with the pathogenesis of many diseases, including primary ciliary dyskinesia, infertility, and tumors (PMID: 37182638). It has been reported that CCDC97 may be involved in Coronary artery disease (PMID: 27386823). Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag36049 Product name: Recombinant human CCDC97 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 225-343 aa of BC011577 Sequence: LQSYEERELQQRLLQQQEEEEACLEEEEEEEDSDEEDQRSGKDSEAWVPDSEERLILREEFTSRMHQRFLDGKDGDFDYSTVDDNPDFDNLDIVARDEEERYFDEEEPEDAPSPELDGD Predict reactive species Full Name: coiled-coil domain containing 97 Observed Molecular Weight: 51 kDa GenBank Accession Number: BC011577 Gene Symbol: CCDC97 Gene ID (NCBI): 90324 RRID: AB_3670170 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: Q96F63 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.