Proteintech, 32022-1-AP, NAXE Polyclonal antibody

Size: 20ul / 150ul The NAXE (32022-1-AP) by Proteintech is a Polyclonal antibody targeting NAXE in WB, IHC, IF/ICC, ELISA applications with reactivity to human, mouse, rat samples 32022-1-AP targets NAXE in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HeLa cells, L02 cells, MCF-7 cells, NIH/3T3 cells, mouse liver tissue, rat kidney tissue Positive IHC detected in: mouse cerebellum tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: A549 cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunohistochemistry (IHC): IHC : 1:300-1:1200 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information NAD(P)H-hydrate epimerase (NAXE, also known as AIBP, YJEFN1, and APOA1BP) catalyzes the interconversion between the S- and R-forms of NAD(P)HX, and essentially supplies the substrate for the stereospecific enzyme NAD(P)HX dehydratase (NAXD) (PMID: 35866541). NAXE variants can cause neurometabolic disorder by disrupting the cellular NAD(P)HX repair system (PMID: 31745726; 27616477). Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag35306 Product name: Recombinant human APOA1BP protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 166-288 aa of NM_144772.2 Sequence: LGEMPAEPMTIDELYELVVDAIFGFSFKGDVREPFHSILSVLKGLTVPIASIDIPSGWDVEKGNAGGIQPDLLISLTAPKKSATQFTGRYHYLGGRFVPPALEKKYQLNLPPYPDTECVYRLQ Predict reactive species Full Name: apolipoprotein A-I binding protein Calculated Molecular Weight: 32 kDa Observed Molecular Weight: 29 kDa GenBank Accession Number: NM_144772.2 Gene Symbol: APOA1BP Gene ID (NCBI): 128240 RRID: AB_3670173 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: Q8NCW5 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.