Product Description
Size: 20ul / 150ul
The NAXE (32022-1-AP) by Proteintech is a Polyclonal antibody targeting NAXE in WB, IHC, IF/ICC, ELISA applications with reactivity to human, mouse, rat samples
32022-1-AP targets NAXE in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.
Tested Applications
Positive WB detected in: HeLa cells, L02 cells, MCF-7 cells, NIH/3T3 cells, mouse liver tissue, rat kidney tissue
Positive IHC detected in: mouse cerebellum tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0
Positive IF/ICC detected in: A549 cells
Recommended dilution
Western Blot (WB): WB : 1:5000-1:50000
Immunohistochemistry (IHC): IHC : 1:300-1:1200
Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800
Background Information
NAD(P)H-hydrate epimerase (NAXE, also known as AIBP, YJEFN1, and APOA1BP) catalyzes the interconversion between the S- and R-forms of NAD(P)HX, and essentially supplies the substrate for the stereospecific enzyme NAD(P)HX dehydratase (NAXD) (PMID: 35866541). NAXE variants can cause neurometabolic disorder by disrupting the cellular NAD(P)HX repair system (PMID: 31745726; 27616477).
Specification
Tested Reactivity: human, mouse, rat
Host / Isotype: Rabbit / IgG
Class: Polyclonal
Type: Antibody
Immunogen: CatNo: Ag35306 Product name: Recombinant human APOA1BP protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 166-288 aa of NM_144772.2 Sequence: LGEMPAEPMTIDELYELVVDAIFGFSFKGDVREPFHSILSVLKGLTVPIASIDIPSGWDVEKGNAGGIQPDLLISLTAPKKSATQFTGRYHYLGGRFVPPALEKKYQLNLPPYPDTECVYRLQ Predict reactive species
Full Name: apolipoprotein A-I binding protein
Calculated Molecular Weight: 32 kDa
Observed Molecular Weight: 29 kDa
GenBank Accession Number: NM_144772.2
Gene Symbol: APOA1BP
Gene ID (NCBI): 128240
RRID: AB_3670173
Conjugate: Unconjugated
Form: Liquid
Purification Method: Antigen affinity Purification
UNIPROT ID: Q8NCW5
Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.
Order Guidelines
1. Price & Stock Available on Request. Click to send email to: service@iright.com
2. Please DO NOT make payment before confirmation.
3. Minimum order value of $1,000 USD required.
Collaboration
Tony Tang
Email: Tony.Tang@iright.com
Mobile/WhatsApp/Wechat: +86-17717886924