Iright
BRAND / VENDOR: Proteintech

Proteintech, 32033-1-AP, RSPH1 Polyclonal antibody

CATALOG NUMBER: 32033-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The RSPH1 (32033-1-AP) by Proteintech is a Polyclonal antibody targeting RSPH1 in WB, ELISA applications with reactivity to human samples 32033-1-AP targets RSPH1 in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: human testis tissue Recommended dilution Western Blot (WB): WB : 1:1000-1:5000 Background Information RSPH1 (Radial Spoke Head Component 1) encodes a male mid-meiotic chromosome-associated acidic protein involved in the structure and function of cilia and flagella. Pathogenic variants of RSPH1 lead to impaired spermatocyte motility and aberrant flagellar composition, which further contribute to male infertility. In addition to this, mutations in the RSPH1 gene lead to primary ciliary dyskinesia-24 (PCD-24), an autosomal recessive disorder that affects the motor function of cilia and flagella. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag36560 Product name: Recombinant human RSPH1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-309 aa of BC101519 Sequence: MSDLGSEELEEEGENDIGEYEGGRNEAGERHGRGRARLPNGDTYEGSYEFGKRHGQGIYKFKNGARYIGEYVRNKKHGQGTFIYPDGSRYEGEWANDLRHGHGVYYYINNDTYTGEWFAHQRHGQGTYLYAETGSKYVGTWVNGQQEGTAELIHLNHRYQGKFLNKNPVGPGKYVFDVGCEQHGEYRLTDMERGEEEEEEELVTVVPKWKATQITELALWTPTLPKKPTSTDGPGQDAPGAESAGEPGEEAQALLEGFEGEMDMRPGDEDADVLREESREYDQEEFRYDMDEGNINSEEEETRQSDLQD Predict reactive species Full Name: radial spoke head 1 homolog (Chlamydomonas) Calculated Molecular Weight: 309 aa, 35 kDa Observed Molecular Weight: 41 kDa GenBank Accession Number: BC101519 Gene Symbol: RSPH1 Gene ID (NCBI): 89765 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: Q8WYR4 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924