Proteintech, 32036-1-AP, ABHD4 Polyclonal antibody

Size: 20ul / 150ul The ABHD4 (32036-1-AP) by Proteintech is a Polyclonal antibody targeting ABHD4 in WB, IHC, ELISA applications with reactivity to human, mouse samples 32036-1-AP targets ABHD4 in WB, IHC, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: A549 cells, HepG2 cells, LNCap cells, SiHa cells, mouse testis tissue Positive IHC detected in: human urothelial carcinoma tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information The alpha/beta hydrolase structural domain-containing protein 4 (ABHD4) gene is a major regulator of mammalian phospholipid metabolism with hydrolase and lysophospholipase activities. ABHD4 is involved in anoikis resistance and endogenous cannabinoid biosynthesis, and ABHD4-mediated developmental anoikis specifically protects embryonic brains from the consequences of sporadic delamination errors and teratogenic damage. Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag36373 Product name: Recombinant human ABHD4 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 250-342 aa of BC024779 Sequence: PSGETAFKAMMESFGWARRPMLERIHLIRKDVPITMIYGSDTWIDTSTGKKVKMQRPDSYVRDMEIKGASHHVYADQPHIFNAVVEEICDSVD Predict reactive species Full Name: abhydrolase domain containing 4 Calculated Molecular Weight: 342 aa, 39 kDa Observed Molecular Weight: 39 kDa GenBank Accession Number: BC024779 Gene Symbol: ABHD4 Gene ID (NCBI): 63874 RRID: AB_3670176 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: Q8TB40 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.