Proteintech, 32040-1-AP, CT55 Polyclonal antibody

Size: 20ul / 150ul The CT55 (32040-1-AP) by Proteintech is a Polyclonal antibody targeting CT55 in WB, ELISA applications with reactivity to human samples 32040-1-AP targets CT55 in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: human testis tissue Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Background Information The Cancer/Testis Antigen (CTA) genes comprise a group of genes whose expression under physiological conditions is restricted to the testis but is activated in many human cancers. CT55 is a new autophagic manipulator to regulate spermatogenesis via selectively interacting with LAMP2 and GABARAP (which are key regulators in the autophagy process) and further fine-tuning their expression. Cancer-testis antigen 55 (CT55) mutation induced male infertility with extreme disruption in sperm production, morphology, and locomotion (PubMed:36481789). Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag36155 Product name: Recombinant human CXorf48 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-168 aa of BC020662 Sequence: MLRLLRLALAFYGRTADPAERQGPQQQGLPQGDTQLTTVQGVVTSFCGDYGMIDESIYFSSDVVTGNVPLKVGQKVNVVVEEDKPHYGLRAIKVDVVPRHLYGAGPSDSGTRVLIGCVTSINEDNIYISNSIYFSIAIVSEDFVPYKGDLLEVEYSTEPGISNIKATS Predict reactive species Full Name: chromosome X open reading frame 48 Observed Molecular Weight: 30 kDa GenBank Accession Number: BC020662 Gene Symbol: CXorf48 Gene ID (NCBI): 54967 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: Q8WUE5 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.