Proteintech, 32046-1-AP, ZNF517 Polyclonal antibody

Size: 20ul / 150ul The ZNF517 (32046-1-AP) by Proteintech is a Polyclonal antibody targeting ZNF517 in IF/ICC, ELISA applications with reactivity to human samples 32046-1-AP targets ZNF517 in IF/ICC, ELISA applications and shows reactivity with human samples. Tested Applications Positive IF/ICC detected in: HepG2 cells Recommended dilution Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information The ZNF family genes are an ancient group of mammalian paralogous homologs, and ZNF517 has been continuously lost during evolution, and although ZNF517 may be involved in transcriptional regulation, its exact function is unknown. A partial deletion and down-regulation of ZNF517 gene expression in cutaneous malignant melanoma (CMM) has been noted. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag37110 Product name: Recombinant human ZNF517 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 280-390 aa of BC126161 Sequence: QKFHTGEKPFACTECGKAFCRRFTLNEHGRIHSGERPYRCLRCGQRFIRGSSLLKHHRLHAQEGAQDGGAGQGALLGAAQRPQAGDPPHECPVCGRPFRHNSLLLLHLRLH Predict reactive species Full Name: zinc finger protein 517 GenBank Accession Number: BC126161 Gene Symbol: ZNF517 Gene ID (NCBI): 340385 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: Q6ZMY9 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.