Proteintech, 32066-1-AP, CACTIN Polyclonal antibody

Size: 20ul / 150ul The CACTIN (32066-1-AP) by Proteintech is a Polyclonal antibody targeting CACTIN in WB, ELISA applications with reactivity to human samples 32066-1-AP targets CACTIN in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HEK-293T cells, HeLa cells, Jurkat cells, MCF-7 cells Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Background Information CACTIN plays a role in pre-mRNA splicing by facilitating excision of a subset of introns (PubMed:28062851).CACTIN was reported to be involved in the regulation of innate immune response (PubMed:20829348). CACTIN acts as a negative regulator of Toll-like receptor, interferon-regulatory factor (IRF) and canonical NF-kappa-B signaling pathways (PubMed:20829348, PubMed:26363554). CACTIN contributes to the regulation of transcriptional activation of NF-kappa-B target genes in response to endogenous pro-inflammatory stimuli (PubMed:20829348, PubMed:26363554). CACTIN has two isforms (89kDa and 108 kDa). Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag35645 Product name: Recombinant human CACTIN protein Source: e coli. -derived, PET30a Tag: 6*His Domain: 1-188 aa of NM_021231 Sequence: MGRDTRSRSRSAGRRGRRRQSQSGSRSRSRSHGRRNRRRREDEGRRRRRRRSRERRSDSEEERWQRSGMRSRSPPRPKWHSRDGSSQSDSGEEQSRGQWARRRRRARSWSPSSSASSSASPGRSQSPRAAAAALSQQQSLQERLRLREERKQQEELMKAFETPEEKRARRLAKKEAKERKKREKMGWG Predict reactive species Full Name: chromosome 19 open reading frame 29 Calculated Molecular Weight: 108 kDa, 89 kDa Observed Molecular Weight: 120 kDa GenBank Accession Number: NM_021231 Gene Symbol: C19orf29 Gene ID (NCBI): 58509 RRID: AB_3670183 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: Q8WUQ7 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.