Proteintech, 32098-1-AP, SEC14L3 Polyclonal antibody

Size: 20ul / 150ul The SEC14L3 (32098-1-AP) by Proteintech is a Polyclonal antibody targeting SEC14L3 in WB, IHC, IF/ICC, ELISA applications with reactivity to human, mouse, rat samples 32098-1-AP targets SEC14L3 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse liver tissue, mouse lung tissue, rat lung tissue Positive IHC detected in: human testis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information SEC14L3 is highly similar to the protein encoded by the Saccharomyces cerevisiae SEC14 gene. The SEC14 protein is a phophatidylinositol transfer protein that is essential for biogenesis of Golgi-derived transport vesicles, and thus is required for the export of yeast secretory proteins from the Golgi complex. The specific function of this protein has not yet been determined. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene. Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag36792 Product name: Recombinant human SEC14L3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 110-182 aa of BC069641 Sequence: GLLFSVTKQDLLKTKMRDCERILHECDLQTERLGKKIETIVMIFDCEGLGLKHFWKPLVEVYQEFFGLLEENY Predict reactive species Full Name: SEC14-like 3 (S. cerevisiae) Calculated Molecular Weight: 46 kDa Observed Molecular Weight: 45 kDa GenBank Accession Number: BC069641 Gene Symbol: SEC14L3 Gene ID (NCBI): 266629 RRID: AB_3670189 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: Q9UDX4 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.