Proteintech, 32103-1-AP, BCL9L Polyclonal antibody

Size: 20ul / 150ul The BCL9L (32103-1-AP) by Proteintech is a Polyclonal antibody targeting BCL9L in WB, IF/ICC, ELISA applications with reactivity to human samples 32103-1-AP targets BCL9L in WB, IF/ICC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: A549 cells, HeLa cells, MCF-7 cells Positive IF/ICC detected in: MCF-7 cells Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Immunofluorescence (IF)/ICC: IF/ICC : 1:400-1:1600 Background Information B-cell CLL/lymphoma 9-like protein (BCL9L, also known as B9L, BCL9-2, and DLNB11) is a transcriptional regulator that acts as an activator, which locates in nucleolus and nucleoplasm (PMID: 33767438). It is predicted to be implicated in the WNT-β-catenin signaling pathway to regulate the progress of hepatocellular carcinoma, breast cancer, and colon cancer (PMID: 31440992; 34545187; 30698996). Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag36794 Product name: Recombinant human BCL9L protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 38-206 aa of NM_182557 Sequence: MHPENKLTNHGKTGNGGAQSQHQNVNQGPTCNVGSKGVGAGNHGAKANQISPSNSSLKNPQAGVPPFSSLKGKVKRDRSVSVDSGEQREAGTPSLDSEAKEVAPRSKRRCVLERKQPYSGDEWCSGPDSEEDDKPIGATHNCNVADPAMAAPQLGPGQTTQLPLSESSV Predict reactive species Full Name: B-cell CLL/lymphoma 9-like Calculated Molecular Weight: 157 kDa Observed Molecular Weight: 220 kDa GenBank Accession Number: NM_182557 Gene Symbol: BCL9L Gene ID (NCBI): 283149 RRID: AB_3670192 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: Q86UU0 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.