Proteintech, 32120-1-AP, MBOAT4 Polyclonal antibody

Size: 20ul / 150ul The MBOAT4 (32120-1-AP) by Proteintech is a Polyclonal antibody targeting MBOAT4 in WB, ELISA applications with reactivity to human samples 32120-1-AP targets MBOAT4 in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HepG2 cells, MCF-7 cells Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Background Information MBOAT4, also known as ghrelin O-acyltransferase (GOAT), is an endoplasmic reticulum enzyme that catalyzes the octanoylation of the peptide hormone ghrelin, which is essential for the binding of ghrelin to its receptor and the subsequent regulation of food intake, growth hormone secretion, and inhibition of insulin secretion (PMID: 34946685). MBOAT4 is considered a potential therapeutic target for treating disorders related to ghrelin signaling (PMID: 32564644). Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag37237 Product name: Recombinant human MBOAT4 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 262-324 aa of NM_001100916 Sequence: DDSLLHAAGFGPELGQSPGEEGYVPDADIWTLERTHRISVFSRKWNQSTARWLRRLVFQHSRA Predict reactive species Full Name: membrane bound O-acyltransferase domain containing 4 Calculated Molecular Weight: 50 kDa Observed Molecular Weight: 50 kDa GenBank Accession Number: NM_001100916 Gene Symbol: MBOAT4 Gene ID (NCBI): 619373 RRID: AB_3670198 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: Q96T53 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.