Iright
BRAND / VENDOR: Proteintech

Proteintech, 32124-1-AP, DGKZ Polyclonal antibody

CATALOG NUMBER: 32124-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The DGKZ (32124-1-AP) by Proteintech is a Polyclonal antibody targeting DGKZ in WB, IHC, IF/ICC, ELISA applications with reactivity to human, mouse, rat samples 32124-1-AP targets DGKZ in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse brain tissue, rat brain tissue Positive IHC detected in: mouse brain tissue, rat brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: A431 cells Recommended dilution Western Blot (WB): WB : 1:1000-1:8000 Immunohistochemistry (IHC): IHC : 1:250-1:1000 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information Diacylglycerol kinase zeta (DGKZ), also known as DAGK5, DAGK6, DGK-ZETA, hDGKzeta, belongs to the diacylglycerol kinase (DGK) family which catalyzes diacylglycerol (DAG) into phosphatidic acid (PA). DGKZ is a novel promoter of metastasis and that it could be a potential prognostic indicator in patients with triple-negative breast cancer by suppressing lipid raft-dependent endocytosis of TGFbetaR2(PMID: 35115500). Downregulation of DGKZ suppresses tumorigenesis and progression of cervical cancer by facilitating cell apoptosis and cell cycle arrest(PMID: 33926342). Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag37336 Product name: Recombinant human DGKZ protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 750-982 aa of NM_001199267.1 Sequence: LDPELLGASARPDLPTPTSPLPTSPCSPTPRSLQGDAAPPQGEELIEAAKRNDFCKLQELHRAGGDLMHRDEQSRTLLHHAVSTGSKDVVRYLLDHAPPEILDAVEENGETCLHQAAALGQRTICHYIVEAGASLMKTDQQGDTPRQRAEKAQDTELAAYLENRQHYQMIQREDQETAV Predict reactive species Full Name: diacylglycerol kinase, zeta 104kDa Calculated Molecular Weight: 104kDa,928aa Observed Molecular Weight: 104-124 kDa GenBank Accession Number: NM_001199267.1 Gene Symbol: DGKZ Gene ID (NCBI): 8525 RRID: AB_3670200 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: Q13574 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924