Proteintech, 32157-1-AP, IGFBP6 Polyclonal antibody

Size: 20ul / 150ul The IGFBP6 (32157-1-AP) by Proteintech is a Polyclonal antibody targeting IGFBP6 in WB, ELISA applications with reactivity to human samples 32157-1-AP targets IGFBP6 in WB, IHC, IP, CoIP, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HeLa cells, SH-SY5Y cells Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Background Information IGFBP6, an O-glycosylated protein with a predicted molecular weight of 34 kDa, can inhibit cell proliferation through specific binding to IGF-II. IGFBP6 is a multifunctional protein that plays significant roles in various cellular activities, including immune response, tissue repair, and fibrosis. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Eg0087 Product name: Recombinant Human IGFBP6 protein (Myc Tag, His Tag) Source: mammalian cells -derived, pHZ-KIsec Tag: Myc & 6*His Domain: 28-240 aa of BC011708 Sequence: RCPGCGQGVQAGCPGGCVEEEDGGSPAEGCAEAEGCLRREGQECGVYTPNCAPGLQCHPPKDDEAPLRALLLGRGRCLPARAPAVAEENPKESKPQAGTARPQDVNRRDQQRNPGTSTTPSQPNSAGVQDTEMGPCRRHLDSVLQQLQTEVYRGAQTLYVPNCDHRGFYRKRQCRSSQGQRRGPCWCVDRMGKSLPGSPDGNGSSSCPTGSSG Predict reactive species Full Name: insulin-like growth factor binding protein 6 Calculated Molecular Weight: 25 kDa Observed Molecular Weight: 34 kDa GenBank Accession Number: BC011708 Gene Symbol: IGFBP6 Gene ID (NCBI): 3489 RRID: AB_3670211 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: P24592 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.