Proteintech, 32169-1-AP, PLEKHA2 Polyclonal antibody

Size: 20ul / 150ul The PLEKHA2 (32169-1-AP) by Proteintech is a Polyclonal antibody targeting PLEKHA2 in WB, IF/ICC, ELISA applications with reactivity to human samples 32169-1-AP targets PLEKHA2 in WB, IF/ICC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HeLa cells, JurKat cells, RT-4 cells Positive IF/ICC detected in: HeLa cells, A431 cells Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information PLEKHA2 (Pleckstrin homology domain containing A2), also known as TAPP2, is a member of the PLEKHA family of proteins.PLEKHA2 is a junctional protein with a Pleckstrin homology domain that is involved in signaling after lymphocyte activation and plays an important role in cytoskeletal reorganization driven by phosphatidylinositol 3-kinase. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag36596 Product name: Recombinant human PLEKHA2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 101-205 aa of BC166639 Sequence: MKDWVEALNQASKITVPKGGGLPMTTEVLKSLAAPPALEKKPQVAYKTEIIGGVVVHTPISQNGGDGQEGSEPGSHTILRRSQSYIPTSGCRASTGPPLIKSGYC Predict reactive species Full Name: pleckstrin homology domain containing, family A (phosphoinositide binding specific) member 2 Observed Molecular Weight: 42 kDa GenBank Accession Number: BC166639 Gene Symbol: PLEKHA2 Gene ID (NCBI): 59339 RRID: AB_3670213 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: Q9HB19 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.