Iright
BRAND / VENDOR: Proteintech

Proteintech, 32176-1-AP, CABP4 Polyclonal antibody

CATALOG NUMBER: 32176-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The CABP4 (32176-1-AP) by Proteintech is a Polyclonal antibody targeting CABP4 in WB, ELISA applications with reactivity to human, mouse, rat samples 32176-1-AP targets CABP4 in WB, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: rat retina tissue, mouse retina tissue Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Background Information CABP4, a member of the calcium-binding protein (CABP) family, is located in photoreceptor synaptic terminals and is directly associated with the C-terminal domain of the Cav1.4α. Mice lacking either Cabp4 or Cav1.4α display a CSNB2-like phenotype. Mutations in CABP4 lead to autosomal recessive congenital stationary night blindness (CSNB) (PMID: 16960802). Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag37335 Product name: Recombinant human CABP4 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-150 aa of NM_145200.3 Sequence: MTTEQARGQQGPNLAIGRQKPPAGVVTPKSDAEEPPLTRKRSKKERGLRGSRKRTGSSGEQTGPEAPGSSNNPPSTGEGPAGAPPASPGPASSRQSHRHRPDSLHDAAQRTYGPLLNRVFGKDRELGPEELDELQAAFEEFDTDRDGYIS Predict reactive species Full Name: calcium binding protein 4 Calculated Molecular Weight: 30kDa,275aa Observed Molecular Weight: 38 kDa GenBank Accession Number: NM_145200.3 Gene Symbol: CABP4 Gene ID (NCBI): 57010 RRID: AB_3670214 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: P57796 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924