Proteintech, 32193-1-AP, TCB1 Polyclonal antibody

Size: 20ul / 150ul The TCB1 (32193-1-AP) by Proteintech is a Polyclonal antibody targeting TCB1 in WB, IHC, ELISA applications with reactivity to mouse, rat samples 32193-1-AP targets TCB1 in WB, IHC, ELISA applications and shows reactivity with mouse, rat samples. Tested Applications Positive WB detected in: EL-4 cells, mouse thymus tissue, rat spleen tissue Positive IHC detected in: rat spleen tissue, mouse spleen tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Specification Tested Reactivity: mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Eg2437 Product name: Recombinant Mouse TCB1 protein (rFc Tag) Source: mammalian cells -derived, pHZ-KIsec-C-rFc Tag: C-rFc Domain: 1-140 aa of Sequence: EDLRNVTPPKVSLFEPSKAEIANKQKATLVCLARGFFPDHVELSWWVNGKEVHSGVSTDPQAYKESNYSYCLSSRLRVSATFWHNPRNHFRCQVQFHGLSEEDKWPEGSPKPVTQNISAEAWGRADCGITSASYQQGVLS Predict reactive species Full Name: TCB1 Calculated Molecular Weight: 19 kDa Observed Molecular Weight: 40 kDa RRID: AB_3670219 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: P01852 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.