Iright
BRAND / VENDOR: Proteintech

Proteintech, 32198-1-AP, C21orf33 Polyclonal antibody

CATALOG NUMBER: 32198-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The C21orf33 (32198-1-AP) by Proteintech is a Polyclonal antibody targeting C21orf33 in WB, ELISA applications with reactivity to human, mouse, rat samples 32198-1-AP targets C21orf33 in WB, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: A549 cells, Hela cells, HepG2 cells, K-562 cells, THP-1 cells, mouse liver tissue, rat liver tissue Recommended dilution Western Blot (WB): WB : 1:2000-1:12000 Background Information GATD3A is a member of glutamine amidotransferase-like class 1 domain-containing (GATD) family. GATD proteins classically generate ammonia by amidolysis from the glutamine amide nitrogen, transferring it to an acceptor substrate in a variety of anabolic reactions involving purine and pyrimidine synthesis (PMID: 9575335). GATD3A restricts the formation of AGEs in mitochondria and is a relevant target for diseases where AGE deposition is a pathological hallmark (PMID: 35307029). Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag37527 Product name: Recombinant human C21orf33 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 42-268 aa of BC002370 Sequence: AARVALVLSGCGVYDGTEIHEASAILVHLSRGGAEVQIFAPDVPQMHVIDHTKGQPSEGESRNVLTESARIARGKITDLANLSAANHDAAIFPGGFGAAKNLSTFAVDGKDCKVNKEVERVLKEFHQAGKPIGLCCIAPVLAAKVLRGVEVTVGHEQEEGGKWPYAGTAEAIKALGAKHCVKEVVEAHVDQKNKVVTTPAFMCETALHYIHDGIGAMVRKVLELTGK Predict reactive species Full Name: chromosome 21 open reading frame 33 Calculated Molecular Weight: 268 aa, 28 kDa Observed Molecular Weight: 28 kDa GenBank Accession Number: BC002370 Gene Symbol: C21orf33 Gene ID (NCBI): 8209 RRID: AB_3670221 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: P0DPI2 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924