Proteintech, 32206-1-AP, C1QL2 Polyclonal antibody

Size: 20ul / 150ul The C1QL2 (32206-1-AP) by Proteintech is a Polyclonal antibody targeting C1QL2 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples 32206-1-AP targets C1QL2 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse brain tissue, rat brain tissue Positive IHC detected in: rat brain tissue, mouse brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information Complement C1q-like protein 2 (C1QL2, also known as CTRP10) is a member of the C1q-like protein family. It is a secreted protein that plays a role in synaptic organization and function. C1QL2 is involved in the formation and maintenance of synapses, particularly in the central nervous system (CNS) (PMID: 20646056). It interacts with specific neurexin-3 isoforms to recruit synaptic vesicles and modulate synaptic transmission. Additionally, C1QL2 has been implicated in the regulation of hippocampal mossy fiber-CA3 synapse function, suggesting its role in synaptic plasticity and memory formation (PMID: 28219683). Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag37614 Product name: Recombinant human C1QL2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 22-80 aa of NM_182528 Sequence: HYEMMGTCRMICDPYTAAPGGEPPGAKAQPPGPSTAALEVMQDLSANPPPPFIQGPKGD Predict reactive species Full Name: complement component 1, q subcomponent-like 2 Calculated Molecular Weight: 29 kDa Observed Molecular Weight: 35 kDa GenBank Accession Number: NM_182528 Gene Symbol: C1QL2 Gene ID (NCBI): 165257 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: Q7Z5L3 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.