Iright
BRAND / VENDOR: Proteintech

Proteintech, 32220-1-AP, NCAPG2 Polyclonal antibody

CATALOG NUMBER: 32220-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The NCAPG2 (32220-1-AP) by Proteintech is a Polyclonal antibody targeting NCAPG2 in WB, ELISA applications with reactivity to human samples 32220-1-AP targets NCAPG2 in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: PC-3 cells Recommended dilution Western Blot (WB): WB : 1:500-1:3000 Background Information NCAPG2 (non-SMC condensin II complex subunit G2) encodes a protein belonging to the non-SMC (structural maintenance protein) subunit family of the Condensin II complex that plays a key role in chromosome condensation and segregation during mitosis. NCAPG2 is positively correlated with cancer stem cell (CSC) markers, and aberrant NCAPG2 expression contributes to tumorigenesis in several human malignancies, such as prostate cancer and low-grade gliomas. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag34991 Product name: Recombinant human NCAPG2 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 928-1143 aa of BC043404 Sequence: ILKEITGSSLIQKTDSDEEVAMLLDTVQKVFQKMLECIARSFRKQPEEGLRLLYSVQRPLHEFITAVQSRHTDTPVHRGVLSTLIAGPVVEISHQLRKVSDVEELTPPEHLSDLPPFSRCLIGIIIKSSNVVRSFLDELKACVASNDIEGIVCLTAAVHIILVINAGKHKSSKVREVAATVHRKLKTFMEITLEEDSIERFLYESSSRTLGELLNS Predict reactive species Full Name: non-SMC condensin II complex, subunit G2 Calculated Molecular Weight: 1143 aa, 131 kDa Observed Molecular Weight: 115 kDa GenBank Accession Number: BC043404 Gene Symbol: NCAPG2 Gene ID (NCBI): 54892 RRID: AB_3670224 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: Q86XI2 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924