Proteintech, 32231-1-AP, WNK3 Polyclonal antibody

Size: 20ul / 150ul The WNK3 (32231-1-AP) by Proteintech is a Polyclonal antibody targeting WNK3 in WB, ELISA applications with reactivity to human samples 32231-1-AP targets WNK3 in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HEK-293 cells, HEK-293T cells Recommended dilution Western Blot (WB): WB : 1:1000-1:8000 Background Information WNK3, is a member of the WNK (With No Lysine [K]) kinase family. It is a serine/threonine kinase that plays important roles in various physiological processes. WNK3 is expressed in brain, lung, kidney, liver and pancreas, and in fetal tissues including placenta, fetal brain, lung and kidney. Very low levels of expression were also detected in fetal heart, thymus, liver and spleen. Isoform 1 is brain-specific. Isoform 3 is kidney-specific. Endogenous WNK3 protein is an active protein kinase when immunoprecipitated from cells and its overexpression increases the survival of HeLa cells by delaying the onset of apoptosis (PMID:16501604). Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag37713 Product name: Recombinant mouse WNK3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 500-650 aa of NM_001002838 Sequence: AGCLEERRDSQCKSMGNVFPQPQNTTLPLAPAQQTGAECEETEVDQHVRQQLLQRKPQQHCSSVTGDNLSEAGAASVIHSDTSSQPSVAYSSNQTMGSQMVSNIPQAEVNVPGQIYSSQQLVGHYQQVSGLQKHSKLTQPQILPLVQGQST Predict reactive species Full Name: WNK lysine deficient protein kinase 3 Calculated Molecular Weight: 1800aa, 198 kDa Observed Molecular Weight: 230 kDa GenBank Accession Number: NM_001002838 Gene Symbol: WNK3 Gene ID (NCBI): 65267 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: Q9BYP7 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.