Proteintech, 32256-1-AP, FAM161A Polyclonal antibody

Size: 20ul / 150ul The FAM161A (32256-1-AP) by Proteintech is a Polyclonal antibody targeting FAM161A in WB, ELISA applications with reactivity to human, rat samples 32256-1-AP targets FAM161A in WB, ELISA applications and shows reactivity with human, rat samples. Tested Applications Positive WB detected in: human placenta tissue, rat liver tissue Recommended dilution Western Blot (WB): WB : 1:500-1:3000 Specification Tested Reactivity: human, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag35562 Product name: Recombinant human FAM161A protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 477-618 aa of BC107163 Sequence: SSRGREQAVRKSEKERMREYQRELEEREEKLKKRPLLFERVAQKNARMAAEKHYSNTLKALGISDEFVSKKGQSGKVLEYFNNQETKSVTEDKESFNEEEKIEERENGEENYFIDTNSQDSYKEKDEANEESEEEKSVEESH Predict reactive species Full Name: family with sequence similarity 161, member A Calculated Molecular Weight: 716 aa, 83 kDa Observed Molecular Weight: 69 kDa GenBank Accession Number: BC107163 Gene Symbol: FAM161A Gene ID (NCBI): 84140 RRID: AB_3670230 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: Q3B820 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.