Iright
BRAND / VENDOR: Proteintech

Proteintech, 32275-1-AP, MPP10 Polyclonal antibody

CATALOG NUMBER: 32275-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The MPP10 (32275-1-AP) by Proteintech is a Polyclonal antibody targeting MPP10 in WB, IF/ICC, ELISA applications with reactivity to human samples 32275-1-AP targets MPP10 in WB, IF/ICC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HeLa cells, MCF-7 cells Positive IF/ICC detected in: A431 cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information MPP10, also known as M phase phosphoprotein 10, is a component of the U3 small nucleolar ribonucleoprotein (U3 snoRNP) complex. The protein localizes to the nucleolus during interphase and to the chromosomes during M phase. It plays a crucial role in the early cleavages during pre-18S ribosomal RNA processing. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag37602 Product name: Recombinant human MPHOSPH10 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 391-654 aa of BC126389 Sequence: TAQKRPENSLLEETLHFDHAVRMAPVITEETTLQLEDIIKQRIRDQAWDDVVRKEKPKEDAYEYKKRLTLDHEKSKLSLAEIYEQEYIKLNQQKTAEEENPEHVEIQKMMDSLFLKLDALSNFHFIPKPPVPEIKVVSNLPAITMEEVAPVSVSDAALLAPEEIKEKNKAGDIKTAAEKTATDKKRERRKKKYQKRMKIKEKEKRRKLLEKSSVDQAGKYSKTVASEKLKQLTKTGKASFIKDEGKDKALKSSQAFFSKLQDQV Predict reactive species Full Name: M-phase phosphoprotein 10 (U3 small nucleolar ribonucleoprotein) Calculated Molecular Weight: 681 aa, 79 kDa Observed Molecular Weight: 105 kDa GenBank Accession Number: BC126389 Gene Symbol: MPHOSPH10 Gene ID (NCBI): 10199 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: O00566 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924