Iright
BRAND / VENDOR: Proteintech

Proteintech, 32288-1-AP, ZNF530 Polyclonal antibody

CATALOG NUMBER: 32288-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The ZNF530 (32288-1-AP) by Proteintech is a Polyclonal antibody targeting ZNF530 in WB, ELISA applications with reactivity to human samples 32288-1-AP targets ZNF530 in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HEK-293 cells, IMR-32 cells, U-251 cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Background Information ZNF530, also known as zinc finger protein 530, is a member of the zinc finger protein family. ZNF530 is expressed in various tissues, including the brain, heart, liver, and pancreas. It has been shown to play a role in the development and progression of cancer, as well as in the regulation of normal cell development and function. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag37782 Product name: Recombinant human ZNF530 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-200 aa of BC060865 Sequence: MAAALRAPTQQVFVAFEDVAIYFSQEEWELLDEMQRLLYRDVMLENFAVMASLGCWCGAVDEGTPSAESVSVEELSQGRTPKADTSTDKSHPCEICTPVLRDILQMIELQASPCGQKLYLGGAPRDFWMSSNLHQLQKLDNGEKLFKVDGDQASFMMNCRFHVSGKPFTFGEVGRDFSATSGLLQHQVTPTIERPHSRIR Predict reactive species Full Name: zinc finger protein 530 Calculated Molecular Weight: 599 aa, 69 kDa Observed Molecular Weight: 70 kDa GenBank Accession Number: BC060865 Gene Symbol: ZNF530 Gene ID (NCBI): 348327 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: Q6P9A1 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924