Iright
BRAND / VENDOR: Proteintech

Proteintech, 32297-1-AP, NXPE4 Polyclonal antibody

CATALOG NUMBER: 32297-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The NXPE4 (32297-1-AP) by Proteintech is a Polyclonal antibody targeting NXPE4 in WB, ELISA applications with reactivity to human, mouse, rat samples 32297-1-AP targets NXPE4 in WB, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse testis tissue, rat testis tissue Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Background Information NXPE4, also known as FAM55D and C11orf33, belongs to thNeurexophilin family. NXPE4 was down-regulated when TNFAIP3, a key regulator in inflammatory bowel disease (IBD), was knocked down, and IBD are closely associated with the incidence of CRC. Thus, NXPE4 may be a key factor in the pathogenesis of IBD and CRC (PMID: 31297877). Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag35198 Product name: Recombinant human NXPE4 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 285-435 aa of NM_001077639.1 Sequence: MEKFNTISVSKCNKETVAMKEKCKFGMTSTIPSGHVWRNTWNPVSCSLATVKMKECLRGKLIYLMGDSTIRQWMEYFKASINTLKSVDLHESGKLQHQLAVDLDRNINIQWQKYCYPLIGSMTYSVKEMEYLTRAIDRTGGEKNTVIVISL Predict reactive species Full Name: family with sequence similarity 55, member D Calculated Molecular Weight: 62 kDa Observed Molecular Weight: 65 kDa GenBank Accession Number: NM_001077639.1 Gene Symbol: FAM55D Gene ID (NCBI): 54827 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: Q6UWF7 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924