Iright
BRAND / VENDOR: Proteintech

Proteintech, 32301-1-AP, OIT3 Polyclonal antibody

CATALOG NUMBER: 32301-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The OIT3 (32301-1-AP) by Proteintech is a Polyclonal antibody targeting OIT3 in WB, ELISA applications with reactivity to human samples 32301-1-AP targets OIT3 in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HepG2 cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Background Information Oncoprotein-induced transcript 3 protein (OIT3) is a liver-specific protein. It is involved in various biological processes, including lipid metabolism and ferroptosis regulation. OIT3 has been shown to mediate macrophage polarization and facilitate hepatocellular carcinoma (HCC) progression by regulating the arachidonic acid metabolism and reactive oxygen species (ROS) accumulation (PMID: 35353239). Additionally, OIT3 is implicated in the regulation of lipid metabolism, particularly in the context of triacylglycerol and very low-density lipoproteins (VLDLs) in the liver (PMID: 36132142). Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag36932 Product name: Recombinant human OIT3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 297-506 aa of NM_152635.2 Sequence: VSNGTHVNILFSLKTCGTVVDVVNDKIVASNLVTGLPKQTPGSSGDFIIRTSKLLIPVTCEFPRLYTISEGYVPNLRNSPLEIMSRNHGIFPFTLEIFKDNEFEEPYREALPTLKLRDSLYFGIEPVVHVSGLESLVESCFATPTSKIDEVLKYYLIRDGCVSDDSVKQYTSRDHLAKHFQVPVFKFVGKDHKEVFLHCRVLVCGVLDER Predict reactive species Full Name: oncoprotein induced transcript 3 Calculated Molecular Weight: 60 kDa,545aa Observed Molecular Weight: 70 kDa GenBank Accession Number: NM_152635.2 Gene Symbol: OIT3 Gene ID (NCBI): 170392 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: Q8WWZ8 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924