Iright
BRAND / VENDOR: Proteintech

Proteintech, 32304-1-AP, MESP1 Polyclonal antibody

CATALOG NUMBER: 32304-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The MESP1 (32304-1-AP) by Proteintech is a Polyclonal antibody targeting MESP1 in WB, ELISA applications with reactivity to human, rat samples 32304-1-AP targets MESP1 in WB, ELISA applications and shows reactivity with human, rat samples. Tested Applications Positive WB detected in: rat skeletal muscle tissue Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Background Information MESP1 is a transiently expressed bHLH transcription factor that serves as a master regulator of mesoderm formation and cardiac lineage specification during early embryogenesis. By activating core cardiovascular transcriptional networks and promoting mesodermal cell migration, MESP1 establishes the foundation for heart development. Perturbation of MESP1 function leads to defective mesoderm patterning and congenital heart disease, underscoring its pivotal role in early developmental programming. Specification Tested Reactivity: human, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag38017 Product name: Recombinant human MESP1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-72 aa of BC006219 Sequence: MAQPLCPPLSESWMLSAAWGPTRRPPPSDKDCGRSLVSSPDSWGSTPADSPVASPARPGTLRDPRAPSVGRR Predict reactive species Full Name: mesoderm posterior 1 homolog (mouse) Calculated Molecular Weight: 268 aa, 29 kDa Observed Molecular Weight: 31 kDa GenBank Accession Number: BC006219 Gene Symbol: MESP1 Gene ID (NCBI): 55897 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: Q9BRJ9 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924