Iright
BRAND / VENDOR: Proteintech

Proteintech, 32307-1-AP, MOSPD1 Polyclonal antibody

CATALOG NUMBER: 32307-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The MOSPD1 (32307-1-AP) by Proteintech is a Polyclonal antibody targeting MOSPD1 in WB, IHC, ELISA applications with reactivity to human samples 32307-1-AP targets MOSPD1 in WB, IHC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: MDA-MB-231 cells, PC-3 cells Positive IHC detected in: mouse cerebellum tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:3000 Immunohistochemistry (IHC): IHC : 1:50-1:200 Background Information MOSPD1, or Motile Sperm Domain-Containing Protein 1, is a protein that has been implicated in various biological processes. It is part of a family of proteins characterized by the presence of the major sperm protein domain and two transmembrane domains (PMID: 21792907). The protein is primarily located in the endoplasmic reticulum and Golgi apparatus, and it can also be found in the nucleus under certain conditions. MOSPD1 plays a significant role in the differentiation and proliferation of mesenchymal stem cells (MSCs). Studies have shown that MOSPD1-null embryonic stem cells exhibit impaired differentiation into various cell lineages, including osteoblasts and adipocytes, indicating its importance in MSC proliferation and differentiation (PMID: 26175344). Additionally, MOSPD1 is involved in the switch between mesenchymal and epithelial cells, suggesting its role in developmental regulation. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag37532 Product name: Recombinant human MOSPD1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-213 aa of BC005700 Sequence: MHQQKRQPELVEGNLPVFVFPTELIFYADDQSTHKQVLTLYNPYEFALKFKVLCTTPNKYVVVDAAGAVKPQCCVDIVIRHRDVRSCHYGVIDKFRLQVSEQSQRKALGRKEVVATLLPSAKEQQKEEEEKRLKEHLTESLFFEQSFQPENRAVSSGPSLLTVFLGVVCIAALMLPTLGDVESLVPLYLHLSVNQKLVAAYILGLITMAILRT Predict reactive species Full Name: motile sperm domain containing 1 Calculated Molecular Weight: 24 kDa Observed Molecular Weight: 25 kDa GenBank Accession Number: BC005700 Gene Symbol: MOSPD1 Gene ID (NCBI): 56180 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: Q9UJG1 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924