Iright
BRAND / VENDOR: Proteintech

Proteintech, 32335-1-AP, PDGFR beta/CD140b Polyclonal antibody

CATALOG NUMBER: 32335-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The PDGFR beta/CD140b (32335-1-AP) by Proteintech is a Polyclonal antibody targeting PDGFR beta/CD140b in WB, ELISA applications with reactivity to mouse, rat samples 32335-1-AP targets PDGFR beta/CD140b in WB, ELISA applications and shows reactivity with mouse, rat samples. Tested Applications Positive WB detected in: C2C12 cells, NIH/3T3 cells, C6 cells Recommended dilution Western Blot (WB): WB : 1:1000-1:6000 Background Information The Platelet-Derived Growth Factor Receptor Beta (PDGFRβ) is a receptor tyrosine kinase that plays a crucial role in various cellular processes, including cell proliferation, migration, and survival. In mice, PDGFRβ is particularly significant due to its expression in pericytes, which are cells that reside on the walls of capillaries and play a vital role in maintaining vascular stability and integrity (PMID: 20738866). In the central nervous system (CNS) of mice, PDGFRβ is predominantly expressed in pericytes and vascular smooth muscle cells. It is involved in the formation and maintenance of the blood-brain barrier, as well as in the regulation of angiogenesis and vascular stability. Research in mouse models has shown that PDGFRβ signaling is crucial for tissue repair and functional recovery after stroke. Mice with disrupted PDGFRβ signaling exhibit delayed recovery and increased infarction volume following cerebral ischemia (PMID: 21952111). The observed MW is about 180 kDa, which may be caused by post-translational modification. Specification Tested Reactivity: mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Eg1533 Product name: Recombinant Mouse PDGFR beta protein (rFc Tag) Source: mammalian cells -derived, pHZ-KIsec-C-rFc Tag: C-rFc Domain: 32-531 aa of NM_008809.2 Sequence: LVITPPGPEFVLNISSTFVLTCSGSAPVMWEQMSQVPWQEAAMNQDGTFSSVLTLTNVTGGDTGEYFCVYNNSLGPELSERKRIYIFVPDPTMGFLPMDSEDLFIFVTDVTETTIPCRVTDPQLEVTLHEKKVDIPLHVPYDHQRGFTGTFEDKTYICKTTIGDREVDSDTYYVYSLQVSSINVSVNAVQTVVRQGESITIRCIVMGNDVVNFQWTYPRMKSGRLVEPVTDYLFGVPSRIGSILHIPTAELSDSGTYTCNVSVSVNDHGDEKAINISVIENGYVRLLETLGDVEIAELHRSRTLRVVFEAYPMPSVLWLKDNRTLGDSGAGELVLSTRNMSETRYVSELILVRVKVSEAGYYTMRAFHEDDEVQLSFKLQVNVPVRVLELSESHPANGEQTIRCRGRGMPQPNVTWSTCRDLKRCPRKLSPTPLGNSSKEESQLETNVTFWEEDQEYEVVSTLRLRHVDQPLSVRCMLQNSMGGDSQEVTVVPHSLPFKV Predict reactive species Full Name: platelet derived growth factor receptor, beta polypeptide Calculated Molecular Weight: 123kDa Observed Molecular Weight: 180 kDa GenBank Accession Number: NM_008809.2 Gene Symbol: PDGFR beta Gene ID (NCBI): 18596 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: P05622-1 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924