Iright
BRAND / VENDOR: Proteintech

Proteintech, 32346-1-AP, Ly-6G Polyclonal antibody

CATALOG NUMBER: 32346-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The Ly-6G (32346-1-AP) by Proteintech is a Polyclonal antibody targeting Ly-6G in WB, FC, ELISA applications with reactivity to mouse samples 32346-1-AP targets Ly-6G in WB, IF, FC, ELISA applications and shows reactivity with mouse samples. Tested Applications Positive WB detected in: mouse bone marrow Positive FC detected in: mouse bone marrow cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Flow Cytometry (FC): FC : 0.25 ug per 10^6 cells in a 100 µl suspension Background Information Ly-6G (lymphocyte antigen 6 complex, locus G), also known as Gr-1, is a 21-25 kDa, glycosylphosphatidylinositol-anchored protein expressed on myeloid lineage cells in mouse bone marrow (PMID: 8360469). The expression of Ly-6G increases on neutrophils as they differentiate from immature cells in the bone marrow to mature cells in the blood and spleen (PMID: 8890901). Specification Tested Reactivity: mouse Cited Reactivity: mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Eg2609 Product name: Recombinant Mouse Ly6g protein (rFc Tag) Source: mammalian cells -derived, V37 Tag: C-rFc Domain: 21-114 aa of NM_001310438.1 Sequence: AERAQGLECYNCIGVPPETSCNTTTCPFSDGFCVALEIEVIVDSHRSKVKSNLCLPICPTTLDNTEITGNAVNVKTYCCKEDLCNAAVPTGGSS Predict reactive species Full Name: lymphocyte antigen 6 complex, locus G Calculated Molecular Weight: 14 kDa Observed Molecular Weight: 20-30 kDa GenBank Accession Number: NM_001310438.1 Gene Symbol: Ly-6G Gene ID (NCBI): 546644 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: P35461 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924