Iright
BRAND / VENDOR: Proteintech

Proteintech, 32382-1-AP, ARHGAP44 Polyclonal antibody

CATALOG NUMBER: 32382-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The ARHGAP44 (32382-1-AP) by Proteintech is a Polyclonal antibody targeting ARHGAP44 in WB, IHC, IF/ICC, ELISA applications with reactivity to human, rat samples 32382-1-AP targets ARHGAP44 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, rat samples. Tested Applications Positive WB detected in: HEK-293 cells, rat brain tissue, LNCaP cells Positive IHC detected in: human urothelial carcinoma tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HEK-293 cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunohistochemistry (IHC): IHC : 1:750-1:3000 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information Rho GTPase-activating protein 44 (ARHGAP44) belongs to the Rho GTPase-activating protein (RhoGAP) family, also known as Rich2.ARHGAP44 plays an important role in cytoskeletal dynamics, cellular motility and signaling. Its high expression in osteosarcoma correlates with tumor malignancy, suggesting its potential as a potential therapeutic target. In addition, ARHGAP44 may also be involved in the pathogenesis of diabetes and cardiovascular diseases, and its specific role in these diseases needs to be further investigated in the future. Specification Tested Reactivity: human, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag38196 Product name: Recombinant human ARHGAP44 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 580-772 aa of NM_001321166 Sequence: LQPGPERTSTTKSKELSPGSAQKGSPGSSQGTACAGTQPGAQPGAQPGASPSPSQPPADQSPHTLRKVSKKLAPIPPKVPFGQPGAMADQSAGQPSPVSLSPTPPSTPSPYGLSYPQGYSLASGQLSPAAAPPLASPSVFTSTLSKSRPTPKPRQRPTLPPPQPPTVNLSASSPQSTEAPMLDGMSPGESMST Predict reactive species Full Name: Rho-type GTPase-activating protein RICH2 Calculated Molecular Weight: 818aa, 89 kDa Observed Molecular Weight: 80-100 kDa GenBank Accession Number: NM_001321166 Gene Symbol: RICH2 Gene ID (NCBI): 9912 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: Q17R89 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924