Proteintech, 32424-1-AP, JAM3 Polyclonal antibody

Size: 20ul / 150ul The JAM3 (32424-1-AP) by Proteintech is a Polyclonal antibody targeting JAM3 in WB, IHC, ELISA applications with reactivity to human samples 32424-1-AP targets JAM3 in WB, IHC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: A375 cells, Jurkat cells, SH-SY5Y cells, SK-N-SH cells Positive IHC detected in: mouse testis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunohistochemistry (IHC): IHC : 1:300-1:1200 Background Information Junctional adhesion molecule 3 (JAM3) is a type I transmembrane glycoprotein containing two Ig-like domains, which is expressed in various tissues and plays a crucial role in cell junctions, cell polarity, and motility (PMID: 34292449; 28931565). It has been proposed that JAM3 participates in leukocyte-platelet interactions, as well as angiogenesis and brain development (PMID: 12208882; 23255084). JAM3 may also be a new marker for predicting the prognosis and immune functions of bladder cancer patients (PMID: 38400838). Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag35750 Product name: Recombinant human JAM3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 32-241 aa of NM_032801.4 Sequence: VNLKSSNRTPVVQEFESVELSCIITDSQTSDPRIEWKKIQDEQTTYVFFDNKIQGDLAGRAEILGKTSLKIWNVTRRDSALYRCEVVARNDRKEIDEIVIELTVQVKPVTPVCRVPKAVPVGKMATLHCQESEGHPRPHYSWYRNDVPLPTDSRANPRFRNSSFHLNSETGTLVFTAVHKDDSGQYYCIASNDAGSARCEEQEMEVYDLN Predict reactive species Full Name: junctional adhesion molecule 3 Calculated Molecular Weight: 35 kDa，310aa Observed Molecular Weight: 35 kDa GenBank Accession Number: NM_032801.4 Gene Symbol: JAM3 Gene ID (NCBI): 83700 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: Q9BX67 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.