Iright
BRAND / VENDOR: Proteintech

Proteintech, 32467-1-AP, KIAA1024 Polyclonal antibody

CATALOG NUMBER: 32467-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The KIAA1024 (32467-1-AP) by Proteintech is a Polyclonal antibody targeting KIAA1024 in WB, ELISA applications with reactivity to human, rat samples 32467-1-AP targets KIAA1024 in WB, ELISA applications and shows reactivity with human, rat samples. Tested Applications Positive WB detected in: rat brain tissue Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Background Information KIAA1024 negatively regulates the activities of mTORC1 and mTORC2 by stabilizing the MTOR complex inhibitor DEPTOR, thus inhibiting cell overgrowth. In cultured hippocampal neurons and PC12 cells, knocking down KIAA1024 can activate mTOR signal and promote neurite outgrowth. However, in zebrafish and mouse transplanted tumor models, deletion of this gene will significantly enhance the tumor formation induced by HRAS(G12V), suggesting that it has antitumor effect. Specification Tested Reactivity: human, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag38274 Product name: Recombinant human KIAA1024 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 742-891 aa of NM_015206.2 Sequence: VGLNEEEIKDTGPGDNKDWHRKSKEADRQYDIPPQHRLPKQPKDGFLVEQVFSPHPYPASLKAHMKSNPLYTDMRLTELAEVKRGQPSWTIEEYARNAGDKGKLTALDLQTQESLNPNNLEYWMEDIYTPGYDSLLKRKEAEFRRAKVCK Predict reactive species Full Name: KIAA1024 Calculated Molecular Weight: 103kDa,916aa Observed Molecular Weight: 102 kDa GenBank Accession Number: NM_015206.2 Gene Symbol: KIAA1024 Gene ID (NCBI): 23251 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: Q9UPX6 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924