Proteintech, 32471-1-AP, JPH4 Polyclonal antibody

Size: 20ul / 150ul The JPH4 (32471-1-AP) by Proteintech is a Polyclonal antibody targeting JPH4 in WB, ELISA applications with reactivity to human, mouse, rat samples 32471-1-AP targets JPH4 in WB, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HepG2 cells, mouse brain tissue, rat brain tissue Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Background Information JPH4 (Junctophilin 4) is a member of the junctophilin family of transmembrane proteins. JPH4 is involved in the formation of junctional membrane complexes between the plasma membrane and the endoplasmic/sarcoplasmic reticulum in excitable cells. It plays a crucial role in maintaining the structural integrity and function of these complexes. JPH4 is biased in expression in the brain (RPKM 34.3) and endometrium (RPKM 8.7), among other tissues. Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag38425 Product name: Recombinant human JPH4 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 450-600 aa of NM_001146028.1 Sequence: GLTPSEGSPELPSSPASSRQPWRPPACRSPLPPGGDQGPFSSPKAWPEEWGGAGAQAEELAGYEAEDEAGMQGPGPRDGSPLLGGCSDSSGSLREEEGEDEEPLPPLRAPAGTEPEPIAMLVLRGSSSRGPDAGCLTEELGEPAATERPAQ Predict reactive species Full Name: junctophilin 4 Calculated Molecular Weight: 66kDa，628aa Observed Molecular Weight: 70 kDa GenBank Accession Number: NM_001146028.1 Gene Symbol: JPH4 Gene ID (NCBI): 84502 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: Q96JJ6 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.