Proteintech, 32474-1-AP, ELOVL3 Polyclonal antibody

Size: 20ul / 150ul The ELOVL3 (32474-1-AP) by Proteintech is a Polyclonal antibody targeting ELOVL3 in WB, ELISA applications with reactivity to human, mouse samples 32474-1-AP targets ELOVL3 in WB, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: human testis tissue, mouse adipose tissue Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Background Information ELOVL3 (elongation of very long-chain fatty acids 3) is a member of the ELOVL family of enzymes that synthesize very long chain fatty acids (VLCFAs). ELOVL3 is expressed primarily in brown and white adipose tissue, skin sebaceous glands, and the liver, synthesizes C20-C24 saturated and monounsaturated fatty acids (PMID: 37847682). ELOVL3 is involved in the regulation of the progression of adipogenesis through activation of peroxisome proliferator-activated receptor (PPAR)γ in mouse adipocytic 3T3-L1 cells (PMID: 22436697, 16326704). Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag24318 Product name: Recombinant human ELOVL3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 18-126 aa of BC034344 Sequence: YNFELSKDMRPFFEEYWATSFPIALIYLVLIAVGQNYMKERKGFNLQGPLILWSFCLAIFSILGAVRMWGIMGTVLLTGGLKQTVCFINFIDNSTVKFWSWVFLLSKVI Predict reactive species Full Name: elongation of very long chain fatty acids (FEN1/Elo2, SUR4/Elo3, yeast)-like 3 Calculated Molecular Weight: 32 kDa Observed Molecular Weight: 32 kDa GenBank Accession Number: BC034344 Gene Symbol: ELOVL3 Gene ID (NCBI): 83401 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: Q9HB03 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.