Proteintech, 32483-1-AP, LELP1 Polyclonal antibody

Size: 20ul / 150ul The LELP1 (32483-1-AP) by Proteintech is a Polyclonal antibody targeting LELP1 in WB, ELISA applications with reactivity to human, rat samples 32483-1-AP targets LELP1 in WB, ELISA applications and shows reactivity with human, rat samples. Tested Applications Positive WB detected in: human testis tissue, rat testis tissue Recommended dilution Western Blot (WB): WB : 1:1000-1:5000 Background Information Late cornified envelope-like proline-rich protein 1 (LELP1) is part of the epidermal differentiation complex (EDC), a cluster of genes that encode proteins essential for the differentiation of keratinocytes and the formation of the stratum corneum (PMID: 34112911). A single nucleotide polymorphism (SNP) in the LELP1 gene has been associated with atopic dermatitis, a chronic inflammatory skin disorder characterized by elevated levels of serum immunoglobulin E (IgE) and severe skin inflammation (PMID: 26608070). Specification Tested Reactivity: human, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag36831 Product name: Recombinant human LELP1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-98 aa of BC130507 Sequence: MSSDDKSKSNDPKTEPKNCDPKCEQKCESKCQPSCLKKLLQRCFEKCPWEKCPAPPKCLPCPSQSPSSCPPQPCTKPCPPKCPSSCPHACPPPCPPPE Predict reactive species Full Name: late cornified envelope-like proline-rich 1 Calculated Molecular Weight: 11 kDa Observed Molecular Weight: 17 kDa GenBank Accession Number: BC130507 Gene Symbol: LELP1 Gene ID (NCBI): 149018 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: Q5T871 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.