Proteintech, 32498-1-AP, ORM1 Polyclonal antibody

Size: 20ul / 150ul The ORM1 (32498-1-AP) by Proteintech is a Polyclonal antibody targeting ORM1 in WB, ELISA applications with reactivity to mouse samples 32498-1-AP targets ORM1 in WB, ELISA applications and shows reactivity with mouse samples. Tested Applications Positive WB detected in: mouse kidney tissue, PNGF treated mouse kidney tissue Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Background Information Orosomucoid-1 (ORM1), also called Alpha-1-acid glycoprotein 1 (AGP1), is a glycoprotein synthesized mostly by hepatocytes. ORM1 is an acute-phase reactant protein controlled by glucocorticoids, interleukin-1 and interleukin-6, and increase up to 5-50 times upon infection and/or inflammation. Anti-apoptotic effect and role as immunomodulator of ORM have been reported. ORM is an important carrier for synthetic drugs and influences their distribution and availability in the body. This antibody recognizes a band about 44 kDa in mouse kidneys which is due to the glycosylation of ORM1. Specification Tested Reactivity: mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Eg2752 Product name: Recombinant Mouse ORM1 protein (rFc Tag) (HPLC verified) Source: mammalian cells -derived, V37 Tag: C-rFc Domain: 19-207 aa of NM_008768.2 Sequence: QNPEHANFTIGEPITNETLSWLSDKWFFMGAAFRKLEYRQAIQTMQSEFFYLTTNLINDTIELRESQTIGDQCVYNSTHLGFQRENGTFSKYEGGVETFAHLIVLRKHGAFMLAFDLKDEKKRGLSLYAKRPDITPELREVFQKAVTHVGMDESEIIFVDWKKDRCGQQEKKQLELGKETKKDPEEGQA Predict reactive species Full Name: orosomucoid 1 Calculated Molecular Weight: 24 kDa Observed Molecular Weight: 23-44 kDa GenBank Accession Number: NM_008768.2 Gene Symbol: Orm1 Gene ID (NCBI): 18405 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: Q60590 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.