Proteintech, 32565-1-AP, LRIT2 Polyclonal antibody

Size: 20ul / 150ul The LRIT2 (32565-1-AP) by Proteintech is a Polyclonal antibody targeting LRIT2 in WB, ELISA applications with reactivity to human, mouse samples 32565-1-AP targets LRIT2 in WB, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: mouse retina tissue Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag38495 Product name: Recombinant human LRIT2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 20-250 aa of BC144475 Sequence: AQPFCLPGCTCSEESFGRTLQCTSVSLGKIPGNLSEEFKQVRIENSPLFEMPQGSFINMSTLEYLWLNFNNISVIHLGALEHLPELRELRLEGNKLCSVPWTAFRATPLLRVLDLKRNKIDALPELALQFLVSLTYLDLSSNRLTVVSKSVFLNWPAYQKCRQPDCGAEILSSLVVALHDNPWVCDCRLRGLVQFVKSITLPVILVNSYLICQGPLSKAGQLFHETELSAC Predict reactive species Full Name: leucine-rich repeat, immunoglobulin-like and transmembrane domains 2 Observed Molecular Weight: 60-70 kDa GenBank Accession Number: BC144475 Gene Symbol: LRIT2 Gene ID (NCBI): 340745 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: A6NDA9 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.