Iright
BRAND / VENDOR: Proteintech

Proteintech, 32593-1-AP, SEC14L2 Polyclonal antibody

CATALOG NUMBER: 32593-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The SEC14L2 (32593-1-AP) by Proteintech is a Polyclonal antibody targeting SEC14L2 in WB, ELISA applications with reactivity to human, mouse samples 32593-1-AP targets SEC14L2 in WB, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: HEK-293T cells, RKO cells, fetal human brain tissue, mouse brain tissue, mouse liver tissue Recommended dilution Western Blot (WB): WB : 1:2000-1:12000 Background Information SEC14L2 (SEC14-like lipid-binding protein 2) is a cytoplasmic protein that belongs to the lipid-binding protein family. It plays an important role in a variety of cellular processes, including endosome division and lipid metabolism. SEC14L2 is able to bind phosphatidylinositol (PtdIns) and regulate its intracellular distribution, which is essential for normal endosome division. It has been shown that SEC14L2 regulates the endosome division process by promoting the conversion of PtdIns4P to PtdIns3P. In addition, SEC14L2 plays a role in the cholesterol biosynthesis pathway by stimulating squalene monooxygenase activity. In terms of viral infection, SEC14L2 is essential for hepatitis C virus (HCV) replication, and its expression promotes HCV replication in cells. Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag35592 Product name: Recombinant human SEC14L2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-218 aa of BC058915 Sequence: MSGRVGDLSPRQKEALAKFRENVQDVLPALPNPDDYFLLRWLRARSFDLQKSEAMLRKHVEFRKQKDIDNIISWQPPEVIQQYLSGGMCGYDLDGCPVWYDIIGPLDAKGLLFSASKQDLLRTKMRECELLLQECAHQTTKLGRKVETITIIYDCEGLGLKHLWKPAVEAYGEFLCMFEENYPETLKRLFVVKAPKLFPVAYNLIKPFLSEDTRKKIM Predict reactive species Full Name: SEC14-like 2 (S. cerevisiae) Calculated Molecular Weight: 46 kDa Observed Molecular Weight: 44 kDa GenBank Accession Number: BC058915 Gene Symbol: SEC14L2 Gene ID (NCBI): 23541 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: O76054 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924