Iright
BRAND / VENDOR: Proteintech

Proteintech, 32608-1-AP, CD16 Polyclonal antibody

CATALOG NUMBER: 32608-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The CD16 (32608-1-AP) by Proteintech is a Polyclonal antibody targeting CD16 in WB, ELISA applications with reactivity to mouse samples 32608-1-AP targets CD16 in WB, ELISA applications and shows reactivity with mouse samples. Tested Applications Positive WB detected in: J774A.1 cells Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Specification Tested Reactivity: mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Eg3474 Product name: Recombinant Mouse CD16 protein (rFc Tag) Source: mammalian cells -derived, pHZ-KIsec-C-rFc Tag: C-rFc Domain: 31-215 aa of NM_001356511 Sequence: ALPKAVVKLDPPWIQVLKEDMVTLMCEGTHNPGNSSTQWFHNGRSIRSQVQASYTFKATVNDSGEYRCQMEQTRLSDPVDLGVISDWLLLQTPQRVFLEGETITLRCHSWRNKLLNRISFFHNEKSVRYHHYKSNFSIPKANHSHSGDYYCKGSLGSTQHQSKPVTITVQDPATTSSISLVWYHT Predict reactive species Full Name: Fc receptor, IgG, low affinity III Calculated Molecular Weight: 30 kDa Observed Molecular Weight: 48-55 kDa GenBank Accession Number: NM_001356511 Gene Symbol: Fcgr3 Gene ID (NCBI): 14131 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: P08508 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924