Proteintech, 32690-1-AP, IFNA21 Polyclonal antibody

Size: 20ul / 150ul The IFNA21 (32690-1-AP) by Proteintech is a Polyclonal antibody targeting IFNA21 in WB, ELISA applications with reactivity to human samples 32690-1-AP targets IFNA21 in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: Recombinant protein Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Background Information IFNA21, also known as Interferon alpha-21, is a member of the type I interferon family. IFNA21 is produced by macrophages and has antiviral activities. It stimulates the production of two enzymes: a protein kinase and an oligoadenylate synthetase, which contribute to its antiviral effects. IFNA21 may also be involved in inflammatory processes in an age-dependent manner and in the progression of coronary artery disease. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag38296 Product name: Recombinant human IFNA21 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 24-189 aa of BC101638 Sequence: CDLPQTHSLGNRRALILLAQMGRISPFSCLKDRHDFGFPQEEFDGNQFQKAQAISVLHEMIQQTFNLFSTKDSSATWEQSLLEKFSTELNQQLNDLEACVIQEVGVEETPLMNVDSILAVKKYFQRITLYLTEKKYSPCAWEVVRAEIMRSFSLSKIFQERLRRKE Predict reactive species Full Name: interferon, alpha 21 GenBank Accession Number: BC101638 Gene Symbol: IFNA21 Gene ID (NCBI): 3452 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: P01568 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.