Iright
BRAND / VENDOR: Proteintech

Proteintech, 32696-1-AP, F8A2 Polyclonal antibody

CATALOG NUMBER: 32696-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The F8A2 (32696-1-AP) by Proteintech is a Polyclonal antibody targeting F8A2 in WB, IF/ICC, ELISA applications with reactivity to human, mouse, rat samples 32696-1-AP targets F8A2 in WB, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: OVCAR-3 cells, SKOV-3 cells, mouse brain tissue, rat brain tissue Positive IF/ICC detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information F8A2 (Coagulation Factor VIII Associated 2) is a protein associated with coagulation factor VIII, which is widely expressed in a variety of cell types, localized mainly in the cytoplasm and nucleus, and also co-localized with Huntington's protein (HTT). Although its specific function is not fully defined, F8A2 may play an important role in intracellular and vesicular transport. In addition, F8A2 co-localizes with ubiquitin in neuronal cells and may be involved in the pathological process of neurodegenerative diseases. Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag38529 Product name: Recombinant human F8A2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 20-216 aa of NM_012151.3 Sequence: GDFLARYRLVSNKLKKRFLRKPNVAEAGEQFGQLGRELRAQECLPYAAWCQLAVARCQQALFHGPGEALALTEAARLFLRQERDARQRLVCPAAYGEPLQAAASALGAAVRLHLELGQPAAAAALCLELAAALRDLGQPAAAAGHFQRAAQLQLPQLPLAALQALGEAASCQLLARDYTGALAVFTRMQRLAREHGS Predict reactive species Full Name: coagulation factor VIII-associated (intronic transcript) 2 Calculated Molecular Weight: 39kDa,371aa Observed Molecular Weight: 38 kDa GenBank Accession Number: NM_012151.3 Gene Symbol: F8A2 Gene ID (NCBI): 474383 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: P23610 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924