Iright
BRAND / VENDOR: Proteintech

Proteintech, 32701-1-AP, ZNF449 Polyclonal antibody

CATALOG NUMBER: 32701-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The ZNF449 (32701-1-AP) by Proteintech is a Polyclonal antibody targeting ZNF449 in IP, ELISA applications with reactivity to human samples 32701-1-AP targets ZNF449 in IP, ELISA applications and shows reactivity with human samples. Tested Applications Positive IP detected in: HEK-293 cells Recommended dilution Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Background Information ZNF449 (Zinc Finger Protein 449) is a member of the zinc-finger family of transcription factors. It is encoded by a gene located on the X chromosome (Xq26.3) and contains an N-terminal SCAN domain and seven C2H2-type zinc finger motifs at the C-terminus. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag36778 Product name: Recombinant human ZNF449 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 200-430 aa of BC060768 Sequence: ENREEPWVKELQDSKEMKQLLDSKIGFEIGIENEEDTSKQKKMETMYPFIVTLEGNALQGPILQKDYVQLENQWETPPEDLQTDLAKLVDQQNPTLGETPENSNLEEPLNPKPHKKKSPGEKPHRCPQCGKCFARKSQLTGHQRIHSGEEPHKCPECGKRFLRSSDLYRHQRLHTGERPYECTVCKKRFTRRSHLIGHQRTHSEEETYKCLECGKSFCHGSSLKRHLKTHT Predict reactive species Full Name: zinc finger protein 449 Observed Molecular Weight: 70 kDa GenBank Accession Number: BC060768 Gene Symbol: ZNF449 Gene ID (NCBI): 203523 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: Q6P9G9 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924