Iright
BRAND / VENDOR: Proteintech

Proteintech, 32715-1-AP, RNF183 Polyclonal antibody

CATALOG NUMBER: 32715-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The RNF183 (32715-1-AP) by Proteintech is a Polyclonal antibody targeting RNF183 in WB, ELISA applications with reactivity to human samples 32715-1-AP targets RNF183 in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: 5637 cells, HCT 116 cells, HT-29 cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Background Information RNF183, or Ring Finger Protein 183, is a member of the RING finger protein family that functions as a ubiquitin ligase. RNF183 exhibits tissue-specific expression patterns, with higher expression levels in the gall bladder, kidney, and other tissues. RNF183 expression levels are increased in patients with IBD, including Crohn's disease and ulcerative colitis (PMID: 32486221). It promotes intestinal inflammation by increasing the ubiquitination and degradation of IkappaBalpha, thereby inducing NF-kappaB activation (PMID: 31889078). RNF183 has also been implicated in other conditions such as chronic kidney disease and Alzheimer's disease. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag36228 Product name: Recombinant human RNF183 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-161 aa of BC013036 Sequence: MAEQQGRELEAECPVCWNPFNNTFHTPKMLDCCHSFCVECLAHLSLVTPARRRLLCPLCRQPTVLASGQPVTDLPTDTAMLTLLRLEPHHVILEGHQLCLKDQPKSRYFLRQPRVYTLDLGPQPGGQTGPPPDTASATVSTPILIPSHHSLRECFRNPQFR Predict reactive species Full Name: ring finger protein 183 Observed Molecular Weight: 30 kDa GenBank Accession Number: BC013036 Gene Symbol: RNF183 Gene ID (NCBI): 138065 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: Q96D59 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924