Iright
BRAND / VENDOR: Proteintech

Proteintech, 32720-1-AP, FAM69C Polyclonal antibody

CATALOG NUMBER: 32720-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The FAM69C (32720-1-AP) by Proteintech is a Polyclonal antibody targeting FAM69C in WB, ELISA applications with reactivity to human, mouse, rat samples 32720-1-AP targets FAM69C in WB, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse brain tissue, mouse retina tissue, rat brain tissue Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Background Information FAM69C is a kinase critically involved in neurodegenerative dementia. Biochemical analyses uncover that FAM69C is a serine/threonine kinase. Phosphoproteomic characterizations reveal that FAM69C substrates are involved in synaptic structure and function. Reduced levels of FAM69C are found in postmortem brains of Alzheimer's disease patients. FAM69C is a protective regulator of memory and a potential therapeutic target for memory loss in neurodegenerative dementia (PMID: 35858575). FAM69C undergoes glycosylation modification, and a 55 kDa band was observed in the literature (PMID: 35858575). The mouse FAM69C has two isoforms, and the predicted molecular weight is 46 kDa and 30 kDa. Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag37611 Product name: Recombinant human DIPK1C protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 300-419 aa of NM_001044369 Sequence: MAFFEPKMREILEQNCTGDEDCNFFDCFSRCDLRVNKCGAQRVNNNLQVICDKIFRHWFSAPLKSSAVSFQLQLQLQEAVQECADPGVPSGNTRRAASSVFWKLRQLLQATLRELQEAEK Predict reactive species Full Name: chromosome 18 open reading frame 51 Calculated Molecular Weight: 46 kDa Observed Molecular Weight: 46 kDa, 55 kDa, 32 kDa GenBank Accession Number: NM_001044369 Gene Symbol: C18orf51 Gene ID (NCBI): 125704 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: Q0P6D2 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924