Proteintech, 32753-1-AP, Beta-2-Microglobulin Polyclonal antibody

Size: 20ul / 150ul The Beta-2-Microglobulin (32753-1-AP) by Proteintech is a Polyclonal antibody targeting Beta-2-Microglobulin in WB, IHC, ELISA applications with reactivity to mouse, rat samples 32753-1-AP targets Beta-2-Microglobulin in WB, IHC, ELISA applications and shows reactivity with mouse, rat samples. Tested Applications Positive WB detected in: mouse lung tissue, mouse spleen tissue, rat lung tissue, rat spleen tissue Positive IHC detected in: rat liver tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Immunohistochemistry (IHC): IHC : 1:200-1:800 Background Information Beta-2-microglobulin (B2M) is a component of MHC class I molecules, which are present on the surface of nearly all nucleated cells. It can be found in body fluids under physiologic conditions as a result of shedding from cell surfaces or intracellular release. B2M has various biological functions, including antigen presentation. Investigations reveal that increased synthesis and release of B2M are present in several malignant diseases. Specification Tested Reactivity: mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Eg3270 Product name: Recombinant Rat Beta-2-Microglobulin protein (rFc Tag) (HPLC verified) Source: mammalian cells -derived, pHZ-KIsec-C-rFc Tag: C-rFc Domain: 21-119 aa of NM_012512.2 Sequence: IQKTPQIQVYSRHPPENGKPNFLNCYVSQFHPPQIEIELLKNGKKIPNIEMSDLSFSKDWSFYILAHTEFTPTETDVYACRVKHVTLKEPKTVTWDRDM Predict reactive species Full Name: beta-2 microglobulin Calculated Molecular Weight: 14 kDa Observed Molecular Weight: 12-14 kDa GenBank Accession Number: NM_012512.2 Gene Symbol: B2m Gene ID (NCBI): 24223 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: P07151 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.