Iright
BRAND / VENDOR: Proteintech

Proteintech, 32780-1-AP, KIR2DS5/CD158g Polyclonal antibody

CATALOG NUMBER: 32780-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The KIR2DS5/CD158g (32780-1-AP) by Proteintech is a Polyclonal antibody targeting KIR2DS5/CD158g in WB, ELISA applications with reactivity to human samples 32780-1-AP targets KIR2DS5/CD158g in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: NK-92 cells, human peripheral blood leukocytes Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Background Information Killer cell immunoglobulin-like receptors (KIRs) are a diverse family of inhibitory and activating receptors expressed on NK cells and a subset of T cells (PMID: 11861603). These polymorphic receptors interact with specific motifs on HLA class I molecules, modulate NK cytolytic activity and are encoded by genes located on chromosome 19q13.4 (PMID: 17069649). KIR2DS5, also known as CD158g or NKAT9, is an activating human NK cell receptor that recognizes C2 epitopes of HLA-C alleles (PMID: 8662091; 28685972). It is a transmembrane protein consisting of an extracellular region containing two C2-type Ig-like domains, a transmembrane region, and a truncated cytoplasmic domain that lacks the immunoreceptor tyrosine-based inhibitory motifs (ITIMs) (PMID: 8662091). KIR2DS5 is expressed on a discrete subset of peripheral blood NK cells and is involved in activating NK cells citotoxicity and cytokine production such as IFN-gamma (PMID: 18624290). Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Eg3719 Product name: Recombinant Human CD158G/KIR2DS5 protein (rFc Tag) Source: mammalian cells -derived, pHZ-KIsec-C-rFc Tag: C-rFc Domain: 22-245 aa of NM_014513.3 Sequence: HEGFRRKPSLLAHPGPLVKSEETVILQCWSDVMFEHFLLHREGTFNHTLRLIGEHIDGVSKGNFSIGRMTQDLAGTYRCYGSVTHSPYQLSAPSDPLDIVITGLYEKPSLSAQPGPTVLAGESVTLSCSSRSSYDMYHLSREGEAHERRLPAGPKVNRTFQADFPLDPATHGGTYRCFGSFRDSPYEWSKSSDPLLVSVTGNSSNSWPSPTEPSSETGNPRHLH Predict reactive species Full Name: killer cell immunoglobulin-like receptor, two domains, short cytoplasmic tail, 5 Calculated Molecular Weight: 34 kDa Observed Molecular Weight: 34 kDa GenBank Accession Number: NM_014513.3 Gene Symbol: KIR2DS5 Gene ID (NCBI): 3810 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: Q14953 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924