Proteintech, 32791-1-AP, TAFA1/FAM19A1 Polyclonal antibody

Size: 20ul / 150ul The TAFA1/FAM19A1 (32791-1-AP) by Proteintech is a Polyclonal antibody targeting TAFA1/FAM19A1 in WB, ELISA applications with reactivity to human, mouse, rat samples 32791-1-AP targets TAFA1/FAM19A1 in WB, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse brain tissue, rat brain tissue, rat cerebellum Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Background Information TAFA1, also named as FAM19A1, is a secreted protein that belongs to a small family of cytokines characterized by a conserved FAFA (FAM19 and TAFA) structural domain. It is predominantly expressed in specific regions of the central nervous system, particularly the brain. Functionally, TAFA1 acts as a chemokine-like factor, playing a crucial role in regulating immune cell migration and activation within the brain, thereby contributing to neuroimmune communication. Furthermore, growing evidence highlights its significance in various pathological processes, including modulating neuroinflammation, influencing the progression of neurodegenerative diseases, and even exhibiting context-dependent roles in certain cancers. TAFA1/FAM19A1 can be detected as about 15 kDa. Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag37253 Product name: Recombinant human FAM19A1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 68-133 aa of BC025746 Sequence: SCLPGKVAGTTRNRPSCVDASIVIGKWWCEMEPCLEGEECKTLPDNSGWMCATGNKIKTTRIHPRT Predict reactive species Full Name: family with sequence similarity 19 (chemokine (C-C motif)-like), member A1 Observed Molecular Weight: 15 kDa GenBank Accession Number: BC025746 Gene Symbol: FAM19A1 Gene ID (NCBI): 407738 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: Q7Z5A9 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.